1ufl/2/2:C/1:A

Sequences
>1ufl-a2-m2-cC (length=99) [Search sequence]
MKLIVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGHGGTTVKMELHEKVRLEIGVSEPFV
KPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRTGEEDE
>1ufl-a2-m1-cA (length=108) [Search sequence]
MKLIVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGHGGETERVETYRGTTVKMELHEKVR
LEIGVSEPFVKPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRTGEED
Structure information
PDB ID 1ufl (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of TT1020 from Thermus thermophilus HB8
Assembly ID 2
Resolution 2.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 27
Sequence identity between the two chains 0.99
Chain information
Chain 1 Chain 2
Model ID 2 1
Chain ID C A
UniProt accession P83820 P83820
Species 300852 (Thermus thermophilus HB8) 300852 (Thermus thermophilus HB8)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1ufl-a2-m2-cC_1ufl-a2-m1-cA.pdb.gz
Full biological assembly
Download: 1ufl-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 1v3r/1/1:C/1:A 1ufl/1/1:C/1:A 1ufl/2/1:C/1:A 1ufl/2/2:C/2:A 1v3r/1/1:A/1:B 1v3r/1/1:C/1:B 1v3s/1/1:B/1:A 1v3s/1/1:C/1:A 1v3s/1/1:C/1:B 1v9o/1/1:B/1:A 1v9o/1/1:C/1:A 1v9o/1/1:C/1:B 1vfj/1/1:B/1:A 1vfj/1/1:C/1:A 1vfj/1/1:C/1:B
  • [Back to Home]