1ufo/3/1:E/1:F

Sequences

>1ufo-a3-m1-cE (length=234) [Search sequence]

RVRTERLTLAGLSVLARIPEAPKALLLALHGLQGSKEHILALLPGYAERGFLLLAFDAPR
HGEREGPPPSSKSPRYVEEVYRVALGFKEEARRVAEEAERRFGLPLFLAGGSLGAFVAHL
LLAEGFRPRGVLAFIGSGFPKLPQGQVVEDPGVLALYQAPPATRGEAYGGVPLLHLHGSR
DHIVPLAREKTLEALRPHYPEGRLARFVEEGAGHTLTPLARVGLAFLEHWLEAR

>1ufo-a3-m1-cF (length=234) [Search sequence]

Structure information

PDB ID	1ufo (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of TT1662 from Thermus thermophilus
Assembly ID	3
Resolution	1.6Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	76
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	F
UniProt accession	P83821	P83821
Species	274 (Thermus thermophilus)	274 (Thermus thermophilus)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	1ufo-a3-m1-cE_1ufo-a3-m1-cF.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	1ufo-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1ufo/1/1:A/1:B 1ufo/2/1:C/1:D