1ulu/1/1:C/1:A

Sequences

>1ulu-a1-m1-cC (length=238) [Search sequence]

LTVDLSGKKALVGVTNQRSLGFAIAAKLKEAGAEVALSYQAERLRPEAEKLAEALGGALL
FRADVTQDEELDALFAGVKEAFGGLDYLVHAIAFAPREAEGRYIDTRRQDWLLALEVSAY
SLVAVARRAEPLLREGGGIVTLTYYASEKVVPKYNVAIAKAALEASVRYLAYELGPKGVR
VNAISAGPVYDRVAQTAPLRRNITQEEVGNLGLFLLSPLASGITGEVVYVDAGYHIGE

>1ulu-a1-m1-cA (length=240) [Search sequence]

Structure information

PDB ID	1ulu (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of tt0143 from Thermus thermophilus HB8
Assembly ID	1
Resolution	2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	102
Sequence identity between the two chains	0.996

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	A
UniProt accession	Q5SLI9	Q5SLI9
Species	274 (Thermus thermophilus)	274 (Thermus thermophilus)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	1ulu-a1-m1-cC_1ulu-a1-m1-cA.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	1ulu-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1ulu/1/1:D/1:B 2wyu/1/1:A/1:C 2wyu/1/1:D/1:B 2wyv/1/1:A/1:D 2wyv/1/1:B/1:C 2wyw/1/1:B/1:A 2wyw/1/1:C/1:D 2yw9/1/1:A/1:B 2yw9/1/1:C/1:D 2yw9/2/1:F/1:E 2yw9/2/1:H/1:G
Other dimers with similar sequences but different poses	2wyu/1/1:B/1:A 1ulu/1/1:A/1:B 1ulu/1/1:C/1:D 2wyu/1/1:D/1:C 2wyv/1/1:B/1:A 2wyv/1/1:C/1:D 2wyw/1/1:B/1:C 2wyw/1/1:D/1:A 2yw9/1/1:A/1:C 2yw9/1/1:D/1:B 2yw9/2/1:E/1:G 2yw9/2/1:F/1:H 2wyu/1/1:D/1:A 1ulu/1/1:A/1:D 1ulu/1/1:C/1:B 2wyu/1/1:B/1:C 2wyv/1/1:B/1:D 2wyv/1/1:C/1:A 2wyw/1/1:B/1:D 2wyw/1/1:C/1:A 2yw9/1/1:A/1:D 2yw9/1/1:C/1:B 2yw9/2/1:E/1:H 2yw9/2/1:F/1:G