1v1h/2/1:F/1:E

Sequences
>1v1h-a2-m1-cF (length=101) [Search sequence]
VSIKKSSGLNFDNTAIAINAGKGLEFDTNTSESPDINPIKTKIGSGIDYNENGAMITKLG
AGLSFDNSGAITIGGYIPEAPRDGQAYVRKDGEWVLLSTFL
>1v1h-a2-m1-cE (length=103) [Search sequence]
VSIKKSSGLNFDNTAIAINAGKGLEFDTNTSESPDINPIKTKIGSGIDYNENGAMITKLG
AGLSFDNSGAITIGGSGYIPEAPRDGQAYVRKDGEWVLLSTFL
Structure information
PDB ID 1v1h (database links: RCSB PDB PDBe PDBj PDBsum)
Title Adenovirus fibre shaft sequence N-terminally fused to the bacteriophage T4 fibritin foldon trimerisation motif with a short linker
Assembly ID 2
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 163
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID F E
UniProt accession P10104 P10104
Species 10665 (Tequatrovirus T4) 10665 (Tequatrovirus T4)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1v1h-a2-m1-cF_1v1h-a2-m1-cE.pdb.gz
Full biological assembly
Download: 1v1h-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1v1h/1/1:B/1:C 1v1h/1/1:C/1:A 1v1h/2/1:D/1:F
Other dimers with similar sequences but different poses
  • 1v1h/2/1:D/1:E 1v1h/1/1:B/1:A 1v1i/1/1:B/1:A
  • [Back to Home]