1v7c/2/1:C/1:D

Sequences

>1v7c-a2-m1-cC (length=351) [Search sequence]

MRPPLIERYRNLLPVSEKTPVISLLEGSTPLIPLKGPEEARKKGIRLYAKYEGLNPTGSF
KDRGMTLAVSKAVEGGAQAVACASTGNTAASAAAYAARAGILAIVVLPAGYVALGKVAQS
LVHGARIVQVEGNFDDALRLTQKLTEAFPVALVNSVNPHRLEGQKTLAFEVVDELGDAPH
YHALPVGNAGNITAHWMGYKAYHALGKAKRLPRMLGFQAAGAAPLVLGRPVERPETLATA
IRIGNPASWQGAVRAKEESGGVIEAVTDEEILFAYRYLAREEGIFCEPASAAAMAGVFKL
LREGRLEPESTVVLTLTGHGLKDPATAERVAELPPPVPARLEAVAAAAGLL

>1v7c-a2-m1-cD (length=351) [Search sequence]

Structure information

PDB ID	1v7c (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of threonine synthase from thermus thermophilus hb8 in complex with a substrate analogue
Assembly ID	2
Resolution	2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	259
Sequence identity between the two chains	1.0
PubMed citation	12952961

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	P83823	P83823
Species	274 (Thermus thermophilus)	274 (Thermus thermophilus)
Function annotation	BioLiP:1v7cC	BioLiP:1v7cD

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	1v7c-a2-m1-cC_1v7c-a2-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	1v7c-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1uim/1/1:A/1:B 1uin/1/1:B/1:A 1v7c/1/1:A/1:B 3aex/1/1:A/1:B 3aey/1/1:B/1:A
Other dimers with similar sequences but different poses	1uin/2/4:B/2:A 1uin/2/3:B/1:A 1uin/2/4:B/1:A 1uin/2/3:B/2:A