1vc1/1/1:A/1:B

Sequences

>1vc1-a1-m1-cA (length=110) [Search sequence]

MNNLKLDIVEQDDKAIVRVQGDIDAYNSSELKEQLRNFISTTSKKKIVLDLSSVSYMDSA GLGTLVVILKDAKINGKEFILSSLKESISRILKLTHLDKIFKITDTVEEA

>1vc1-a1-m1-cB (length=110) [Search sequence]

MNNLKLDIVEQDDKAIVRVQGDIDAYNSSELKEQLRNFISTTSKKKIVLDLSSVSYMDSA GLGTLVVILKDAKINGKEFILSSLKESISRILKLTHLDKIFKITDTVEEA

Structure information

PDB ID	1vc1 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the TM1442 protein from Thermotoga maritima, a homolog of the Bacillus subtilis general stress response anti-anti-sigma factor RsbV
Assembly ID	1
Resolution	2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	59
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q9X1F5	Q9X1F5
Species	2336 (Thermotoga maritima)	2336 (Thermotoga maritima)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1vc1-a1-m1-cA_1vc1-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 1vc1-assembly1.cif.gz