1vc3/2/3:B/4:B

Sequences

>1vc3-a2-m3-cB (length=95) [Search sequence]

VTVDQDLLDAAGILPFEQVDIYDITNGARLTTYALPGERGSGVIGINGAAAHLVKPGDLV ILVAYGVFDEEEARNLKPTVVLVDERNRILEVRKG

>1vc3-a2-m4-cB (length=95) [Search sequence]

VTVDQDLLDAAGILPFEQVDIYDITNGARLTTYALPGERGSGVIGINGAAAHLVKPGDLV ILVAYGVFDEEEARNLKPTVVLVDERNRILEVRKG

Structure information

PDB ID	1vc3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of L-Aspartate-alpha-Decarboxylase
Assembly ID	2
Resolution	1.5Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	32
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	3	4
Chain ID	B	B
UniProt accession	Q5SKN7	Q5SKN7
Species	274 (Thermus thermophilus)	274 (Thermus thermophilus)
Function annotation	BioLiP:1vc3B	BioLiP:1vc3B

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1vc3-a2-m3-cB_1vc3-a2-m4-cB.pdb.gz

Full biological assembly Download: 1vc3-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1vc3/1/1:B/2:B 1vc3/2/1:B/2:B 1vc3/2/1:B/4:B 1vc3/2/2:B/3:B 2eeo/1/1:B/3:B 2eeo/1/1:B/4:B 2eeo/1/2:B/3:B 2eeo/1/2:B/4:B