1vc3/2/3:B/4:B

Sequences
>1vc3-a2-m3-cB (length=95) [Search sequence]
VTVDQDLLDAAGILPFEQVDIYDITNGARLTTYALPGERGSGVIGINGAAAHLVKPGDLV
ILVAYGVFDEEEARNLKPTVVLVDERNRILEVRKG
>1vc3-a2-m4-cB (length=95) [Search sequence]
VTVDQDLLDAAGILPFEQVDIYDITNGARLTTYALPGERGSGVIGINGAAAHLVKPGDLV
ILVAYGVFDEEEARNLKPTVVLVDERNRILEVRKG
Structure information
PDB ID 1vc3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of L-Aspartate-alpha-Decarboxylase
Assembly ID 2
Resolution 1.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 32
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 3 4
Chain ID B B
UniProt accession Q5SKN7 Q5SKN7
Species 274 (Thermus thermophilus) 274 (Thermus thermophilus)
Function annotation BioLiP:1vc3B BioLiP:1vc3B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1vc3-a2-m3-cB_1vc3-a2-m4-cB.pdb.gz
Full biological assembly
Download: 1vc3-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1vc3/1/1:B/2:B 1vc3/2/1:B/2:B 1vc3/2/1:B/4:B 1vc3/2/2:B/3:B 2eeo/1/1:B/3:B 2eeo/1/1:B/4:B 2eeo/1/2:B/3:B 2eeo/1/2:B/4:B

[Back to Home]