1vf6/3/1:A/2:A

Sequences
>1vf6-a3-m1-cA (length=58) [Search sequence]
VLQVLDRLKMKLQEKGDTSQNEKLSMFYETLKSPLFNQILTLQQSIKQLKGQLNHILE
>1vf6-a3-m2-cA (length=58) [Search sequence]
VLQVLDRLKMKLQEKGDTSQNEKLSMFYETLKSPLFNQILTLQQSIKQLKGQLNHILE
Structure information
PDB ID 1vf6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title 2.1 Angstrom crystal structure of the PALS-1-L27N and PATJ L27 heterodimer complex
Assembly ID 3
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 15
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession Q8NI35 Q8NI35
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1vf6-a3-m1-cA_1vf6-a3-m2-cA.pdb.gz
Full biological assembly
Download: 1vf6-assembly3.cif.gz

[Back to Home]