1vf6/3/1:B/2:B

Sequences

>1vf6-a3-m1-cB (length=60) [Search sequence]

LQVLQVLDRLKMKLQEKGDTSQNEKLSMFYETLKSPLFNQILTLQQSIKQLKGQLNHILE

>1vf6-a3-m2-cB (length=60) [Search sequence]

LQVLQVLDRLKMKLQEKGDTSQNEKLSMFYETLKSPLFNQILTLQQSIKQLKGQLNHILE

Structure information

PDB ID	1vf6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	2.1 Angstrom crystal structure of the PALS-1-L27N and PATJ L27 heterodimer complex
Assembly ID	3
Resolution	2.1Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	13
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	2
Chain ID	B	B
UniProt accession	Q8NI35	Q8NI35
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 1vf6-a3-m1-cB_1vf6-a3-m2-cB.pdb.gz

Full biological assembly Download: 1vf6-assembly3.cif.gz