1vf6/4/1:A/1:B

Sequences
>1vf6-a4-m1-cA (length=58) [Search sequence]
VLQVLDRLKMKLQEKGDTSQNEKLSMFYETLKSPLFNQILTLQQSIKQLKGQLNHILE
>1vf6-a4-m1-cB (length=60) [Search sequence]
LQVLQVLDRLKMKLQEKGDTSQNEKLSMFYETLKSPLFNQILTLQQSIKQLKGQLNHILE
Structure information
PDB ID 1vf6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title 2.1 Angstrom crystal structure of the PALS-1-L27N and PATJ L27 heterodimer complex
Assembly ID 4
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 30
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q8NI35 Q8NI35
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1vf6-a4-m1-cA_1vf6-a4-m1-cB.pdb.gz
Full biological assembly
Download: 1vf6-assembly4.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1vf6/3/1:A/1:B 1vf6/3/2:A/2:B

[Back to Home]