1vyh/5/1:Q/1:R

Sequences

>1vyh-a5-m1-cQ (length=218) [Search sequence]

SNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSP
LHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLI
NTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGA
ISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEE

>1vyh-a5-m1-cR (length=218) [Search sequence]

Structure information

PDB ID	1vyh (database links: RCSB PDB PDBe PDBj PDBsum)
Title	PAF-AH Holoenzyme: Lis1/Alfa2
Assembly ID	5
Resolution	3.4Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	83
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	Q	R
UniProt accession	P68402	P68402
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	1vyh-a5-m1-cQ_1vyh-a5-m1-cR.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	1vyh-assembly5.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1vyh/1/1:A/1:B 1vyh/2/1:E/1:F 1vyh/3/1:I/1:J 1vyh/4/1:M/1:N