1vzj/2/1:F/1:G

Sequences
>1vzj-a2-m1-cF (length=33) [Search sequence]
DTLDEAERQWKAEFHRWSSYVHWKNQFDHYSKQ
>1vzj-a2-m1-cG (length=33) [Search sequence]
DTLDEAERQWKAEFHRWSSYVHWKNQFDHYSKQ
Structure information
PDB ID 1vzj (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of the tetramerization domain of acetylcholinesterase: four-fold interaction of a WWW motif with a left-handed polyproline helix
Assembly ID 2
Resolution 2.35Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 12
Sequence identity between the two chains 1.0
PubMed citation 15526038
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID F G
UniProt accession P22303 P22303
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:1vzjF BioLiP:1vzjG
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1vzj-a2-m1-cF_1vzj-a2-m1-cG.pdb.gz
Full biological assembly
Download: 1vzj-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1vzj/1/1:A/1:B 1vzj/1/1:B/1:C 1vzj/1/1:C/1:D 1vzj/2/1:E/1:F 1vzj/2/1:H/1:G

[Back to Home]