1w19/1/1:B/2:D

Sequences
>1w19-a1-m1-cB (length=147) [Search sequence]
DASGVRLAIVASSWHGKICDALLDGARKVAAGCGLDDPTVVRVLGAIEIPVVAQELARNH
DAVVALGVVIRGQTPHFDYVCDAVTQGLTRVSLDSSTPIANGVLTTNTEEQALDRAGLPT
SAEDKGAQATVAALATALTLRELRAHS
>1w19-a1-m2-cD (length=147) [Search sequence]
DASGVRLAIVASSWHGKICDALLDGARKVAAGCGLDDPTVVRVLGAIEIPVVAQELARNH
DAVVALGVVIRGQTPHFDYVCDAVTQGLTRVSLDSSTPIANGVLTTNTEEQALDRAGLPT
SAEDKGAQATVAALATALTLRELRAHS
Structure information
PDB ID 1w19 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Lumazine Synthase from Mycobacterium tuberculosis bound to 3-(1,3,7- trihydro-9-D-ribityl-2,6,8-purinetrione-7-yl)propane 1-phosphate
Assembly ID 1
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 35
Sequence identity between the two chains 1.0
PubMed citation 15723519
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID B D
UniProt accession P9WHE9 P9WHE9
Species 1773 (Mycobacterium tuberculosis) 1773 (Mycobacterium tuberculosis)
Function annotation BioLiP:1w19B BioLiP:1w19D
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1w19-a1-m1-cB_1w19-a1-m2-cD.pdb.gz
Full biological assembly
Download: 1w19-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1w19/1/1:C/2:C 1w19/1/1:D/2:B 1w19/1/1:E/2:A 1w19/1/2:E/1:A 1w29/1/1:A/2:E 1w29/1/1:C/2:C 1w29/1/1:D/2:B 1w29/1/1:E/2:A 1w29/1/2:D/1:B
Other dimers with similar sequences but different poses
  • 1w29/1/2:D/2:E 1w19/1/1:A/1:B 1w19/1/1:C/1:B 1w19/1/1:C/1:D 1w19/1/1:E/1:A 1w19/1/1:E/1:D 1w19/1/2:A/2:B 1w19/1/2:C/2:B 1w19/1/2:C/2:D 1w19/1/2:E/2:A 1w19/1/2:E/2:D 1w29/1/1:A/1:B 1w29/1/1:A/1:E 1w29/1/1:C/1:B 1w29/1/1:C/1:D 1w29/1/1:D/1:E 1w29/1/2:A/2:B 1w29/1/2:A/2:E 1w29/1/2:C/2:B 1w29/1/2:C/2:D 2c92/1/1:A/1:B 2c92/1/1:B/1:C 2c92/1/1:C/1:D 2c92/1/1:E/1:A 2c92/1/1:E/1:D 2c94/1/1:A/1:B 2c94/1/1:A/1:E 2c94/1/1:B/1:C 2c94/1/1:C/1:D 2c94/1/1:D/1:E 2c97/1/1:A/1:B 2c97/1/1:C/1:B 2c97/1/1:C/1:D 2c97/1/1:E/1:A 2c97/1/1:E/1:D 2c9b/1/1:A/1:B 2c9b/1/1:C/1:B 2c9b/1/1:C/1:D 2c9b/1/1:E/1:A 2c9b/1/1:E/1:D 2c9b/2/1:F/1:G 2c9b/2/1:H/1:G 2c9b/2/1:H/1:I 2c9b/2/1:J/1:F 2c9b/2/1:J/1:I 2c9d/1/1:A/1:B 2c9d/1/1:C/1:B 2c9d/1/1:C/1:D 2c9d/1/1:E/1:A 2c9d/1/1:E/1:D 2c9d/2/1:F/1:G 2c9d/2/1:H/1:G 2c9d/2/1:H/1:I 2c9d/2/1:J/1:F 2c9d/2/1:J/1:I 2vi5/1/1:A/1:E 2vi5/1/1:B/1:A 2vi5/1/1:C/1:B 2vi5/1/1:C/1:D 2vi5/1/1:D/1:E 2vi5/2/1:F/1:G 2vi5/2/1:G/1:H 2vi5/2/1:H/1:I 2vi5/2/1:J/1:F 2vi5/2/1:J/1:I
  • 1w19/1/2:E/1:B 1w19/1/1:A/2:A 1w19/1/1:E/2:B 1w29/1/1:A/2:A
  • [Back to Home]