1w2e/1/2:A/2:B

Sequences

>1w2e-a1-m2-cA (length=89) [Search sequence]

NTLTVQILDKEYCINCPDDERANLESAARYLDGKREIRSSGKVIGADRVAVAALNITHDL LHRKERLDQESSSTRERVRELLDRVDRAL

>1w2e-a1-m2-cB (length=89) [Search sequence]

TLTVQILDKEYCINCPDDERANLESAARYLDGKREIRSSGKVIGADRVAVAALNITHDLL HRKERLDQESSSTRERVRELLDRVDRALA

Structure information

PDB ID	1w2e (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The Crystal Structure of the Bacterial Cell Division Protein ZapA
Assembly ID	1
Resolution	2.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	101
Sequence identity between the two chains	0.989

Chain information

	Chain 1	Chain 2
Model ID	2	2
Chain ID	A	B
UniProt accession	Q9HTW3	Q9HTW3
Species	287 (Pseudomonas aeruginosa)	287 (Pseudomonas aeruginosa)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 1w2e-a1-m2-cA_1w2e-a1-m2-cB.pdb.gz

Full biological assembly Download: 1w2e-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1t3u/1/1:A/1:B 1w2e/1/1:A/1:B
Other dimers with similar sequences but different poses	1w2e/1/1:A/2:B 1t3u/1/1:C/1:B 1w2e/1/1:B/2:A 1t3u/1/1:D/1:B 1w2e/1/1:A/2:A 1t3u/1/1:A/1:C 1w2e/1/1:B/2:B