1w7z/1/1:B/1:F

Sequences
>1w7z-a1-m1-cB (length=31) [Search sequence]
GCPRILIRCKQDSDCLAGCVCGPNGFCGSPA
>1w7z-a1-m1-cF (length=31) [Search sequence]
GCPRILIRCKQDSDCLAGCVCGPNGFCGSPA
Structure information
PDB ID 1w7z (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the free (uncomplexed) Ecballium elaterium trypsin inhibitor (EETI-II)
Assembly ID 1
Resolution 1.67Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 11
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B F
UniProt accession P12071 P12071
Species 3679 (Ecballium elaterium) 3679 (Ecballium elaterium)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1w7z-a1-m1-cB_1w7z-a1-m1-cF.pdb.gz
Full biological assembly
Download: 1w7z-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1w7z/1/1:A/1:C 1w7z/1/1:B/1:D 1w7z/1/1:D/1:F 1w7z/1/1:E/1:A 1w7z/1/1:E/1:C
Other dimers with similar sequences but different poses
  • 1w7z/1/1:C/1:D 1w7z/1/1:A/1:B 1w7z/1/1:E/1:F
  • 1w7z/1/1:A/1:F 1w7z/1/1:B/1:C 1w7z/1/1:E/1:D
  • [Back to Home]