1wbi/1/1:B/1:D

Sequences
>1wbi-a1-m1-cB (length=120) [Search sequence]
RKCSLTGEWDNDLGSIMTIGAVNDNGEFDGTYITAVADNPGNITLSPLLGIQHKRASQPT
FGFTVHWNFSESTSVFVGQCFVDRSGKEVLKTKWLQRLAVDDISDDWIATRVGNNDFTRQ
>1wbi-a1-m1-cD (length=121) [Search sequence]
ARKCSLTGEWDNDLGSIMTIGAVNDNGEFDGTYITAVADNPGNITLSPLLGIQHKRASQP
TFGFTVHWNFSESTSVFVGQCFVDRSGKEVLKTKWLQRLAVDDISDDWIATRVGNNDFTR
Q
Structure information
PDB ID 1wbi (database links: RCSB PDB PDBe PDBj PDBsum)
Title AVR2
Assembly ID 1
Resolution 1.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 150
Sequence identity between the two chains 1.0
PubMed citation 16212654
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B D
UniProt accession P56732 P56732
Species 9031 (Gallus gallus) 9031 (Gallus gallus)
Function annotation BioLiP:1wbiB BioLiP:1wbiD
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1wbi-a1-m1-cB_1wbi-a1-m1-cD.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 1wbi-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1wbi/1/1:C/1:A 1wbi/2/1:E/1:H 1wbi/2/1:G/1:F
Other dimers with similar sequences but different poses
  • 1wbi/2/1:E/1:F 1wbi/1/1:B/1:C 1wbi/1/1:D/1:A 1wbi/2/1:G/1:H
  • [Back to Home]