1wdf/1/3:A/3:B

Sequences

>1wdf-a1-m3-cA (length=91) [Search sequence]

QKMIASAFNNALGAIQDGFDATNSALGKIQSVVNANAEALNNLLNQLSNRFGAIDLSLDF EKLNVTLLDLTYEMNRIQDAIKKLNESYINL

>1wdf-a1-m3-cB (length=93) [Search sequence]

NQKMIASAFNNALGAIQDGFDATNSALGKIQSVVNANAEALNNLLNQLSNRFGADLSLDF EKLNVTLLDLTYEMNRIQDAIKKLNESYINLKE

Structure information

PDB ID	1wdf (database links: RCSB PDB PDBe PDBj PDBsum)
Title	crystal structure of MHV spike protein fusion core
Assembly ID	1
Resolution	2.5Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	19
Sequence identity between the two chains	0.989

Chain information

	Chain 1	Chain 2
Model ID	3	3
Chain ID	A	B
UniProt accession	P11224	P11224
Species	11142 (Murine hepatitis virus strain A59)	11142 (Murine hepatitis virus strain A59)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 1wdf-a1-m3-cA_1wdf-a1-m3-cB.pdb.gz

Full biological assembly Download: 1wdf-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1wdf/1/1:A/1:B 1wdf/1/2:A/2:B
Other dimers with similar sequences but different poses	1wdf/2/2:A/3:A 1wdf/1/1:A/2:A 1wdf/1/1:A/3:A 1wdf/1/2:A/3:A 1wdf/2/1:A/2:A 1wdf/2/1:A/3:A