1wdf/2/2:A/3:A

Sequences
>1wdf-a2-m2-cA (length=91) [Search sequence]
QKMIASAFNNALGAIQDGFDATNSALGKIQSVVNANAEALNNLLNQLSNRFGAIDLSLDF
EKLNVTLLDLTYEMNRIQDAIKKLNESYINL
>1wdf-a2-m3-cA (length=91) [Search sequence]
QKMIASAFNNALGAIQDGFDATNSALGKIQSVVNANAEALNNLLNQLSNRFGAIDLSLDF
EKLNVTLLDLTYEMNRIQDAIKKLNESYINL
Structure information
PDB ID 1wdf (database links: RCSB PDB PDBe PDBj PDBsum)
Title crystal structure of MHV spike protein fusion core
Assembly ID 2
Resolution 2.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 104
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID A A
UniProt accession P11224 P11224
Species 11142 (Murine hepatitis virus strain A59) 11142 (Murine hepatitis virus strain A59)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1wdf-a2-m2-cA_1wdf-a2-m3-cA.pdb.gz
Full biological assembly
Download: 1wdf-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1wdf/1/1:A/2:A 1wdf/1/1:A/3:A 1wdf/1/2:A/3:A 1wdf/2/1:A/2:A 1wdf/2/1:A/3:A
Other dimers with similar sequences but different poses
  • 1wdf/1/3:A/3:B 1wdf/1/1:A/1:B 1wdf/1/2:A/2:B
  • [Back to Home]