1wdg/2/2:B/3:B

Sequences
>1wdg-a2-m2-cB (length=74) [Search sequence]
QKMIASAFNNALGAIQDGFDATNSALGKIQSVVNANAEALNNLLNQLSLDLTYEMNRIQD
AIKKLNESYINLKE
>1wdg-a2-m3-cB (length=74) [Search sequence]
QKMIASAFNNALGAIQDGFDATNSALGKIQSVVNANAEALNNLLNQLSLDLTYEMNRIQD
AIKKLNESYINLKE
Structure information
PDB ID 1wdg (database links: RCSB PDB PDBe PDBj PDBsum)
Title crystal structure of MHV spike protein fusion core
Assembly ID 2
Resolution 2.06Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 87
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID B B
UniProt accession P11224 P11224
Species 11142 (Murine hepatitis virus strain A59) 11142 (Murine hepatitis virus strain A59)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1wdg-a2-m2-cB_1wdg-a2-m3-cB.pdb.gz
Full biological assembly
Download: 1wdg-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1wdg/1/1:B/2:B 1wdg/1/1:B/3:B 1wdg/1/2:B/3:B 1wdg/2/1:B/2:B 1wdg/2/1:B/3:B 1wdg/3/1:A/4:A 1wdg/3/1:A/5:A 1wdg/3/4:A/5:A

[Back to Home]