1wkj/1/2:B/3:B

Sequences
>1wkj-a1-m2-cB (length=137) [Search sequence]
MERTFVMIKPDGVRRGLVGEILARFERKGFRIAALKLMQISQELAERHYAEHREKPFFPG
LVRFITSGPVVAMVLEGPGVVAEVRKMMGATHPKDALPGTIRGDFATTIDENVIHGSATL
EDAQREIALFFRPEELL
>1wkj-a1-m3-cB (length=137) [Search sequence]
MERTFVMIKPDGVRRGLVGEILARFERKGFRIAALKLMQISQELAERHYAEHREKPFFPG
LVRFITSGPVVAMVLEGPGVVAEVRKMMGATHPKDALPGTIRGDFATTIDENVIHGSATL
EDAQREIALFFRPEELL
Structure information
PDB ID 1wkj (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of Nucleoside Diphosphate Kinase from Thermus thermophilus HB8
Assembly ID 1
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 31
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID B B
UniProt accession Q5SLV5 Q5SLV5
Species 274 (Thermus thermophilus) 274 (Thermus thermophilus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1wkj-a1-m2-cB_1wkj-a1-m3-cB.pdb.gz
Full biological assembly
Download: 1wkj-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1wkj/1/1:A/2:A 1wkj/1/1:A/3:A 1wkj/1/1:B/2:B 1wkj/1/1:B/3:B 1wkj/1/2:A/3:A 1wkk/1/1:A/2:A 1wkk/1/1:A/3:A 1wkk/1/1:B/2:B 1wkk/1/1:B/3:B 1wkk/1/2:A/3:A 1wkk/1/2:B/3:B 1wkl/1/1:A/2:A 1wkl/1/1:A/3:A 1wkl/1/1:B/2:B 1wkl/1/1:B/3:B 1wkl/1/2:A/3:A 1wkl/1/2:B/3:B 1wkl/2/1:A/2:A 1wkl/2/1:A/3:A 1wkl/2/1:B/2:B 1wkl/2/1:B/3:B 1wkl/2/2:A/3:A 1wkl/2/2:B/3:B 1wkl/2/4:A/5:A 1wkl/2/4:A/6:A 1wkl/2/4:B/5:B 1wkl/2/4:B/6:B 1wkl/2/5:A/6:A 1wkl/2/5:B/6:B
Other dimers with similar sequences but different poses
  • 1wkj/1/3:A/3:B 1wkj/1/1:A/1:B 1wkj/1/2:A/2:B 1wkk/1/1:A/1:B 1wkk/1/2:A/2:B 1wkk/1/3:A/3:B 1wkl/1/1:A/1:B 1wkl/1/2:A/2:B 1wkl/1/3:A/3:B 1wkl/2/1:A/1:B 1wkl/2/2:A/2:B 1wkl/2/3:A/3:B 1wkl/2/4:A/4:B 1wkl/2/5:A/5:B 1wkl/2/6:A/6:B
  • 1wkl/2/2:B/6:B 1wkl/2/1:B/4:B 1wkl/2/3:B/5:B
  • 1wkl/2/3:B/6:B 1wkl/2/1:B/5:B 1wkl/2/2:B/4:B
    		•

    [Back to Home]