1wmg/1/1:F/1:E

Sequences
>1wmg-a1-m1-cF (length=83) [Search sequence]
AFKIPLSIRQKICSSLDAPNSRGNDWRLLAQKLSDRYLNYFATKASPTGVILDLWEARQQ
DDGDLNSLASALEEGKSELVAAT
>1wmg-a1-m1-cE (length=84) [Search sequence]
YAFKIPLSIRQKICSSLDAPNSRGNDWRLLAQKLSDRYLNYFATKASPTGVILDLWEARQ
QDDGDLNSLASALEEGKSELVAAT
Structure information
PDB ID 1wmg (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the UNC5H2 death domain
Assembly ID 1
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 28
Sequence identity between the two chains 1.0
PubMed citation 17139086
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID F E
UniProt accession Q8K1S3 Q8K1S3
Species 10090 (Mus musculus) 10090 (Mus musculus)
Function annotation BioLiP:1wmgE
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1wmg-a1-m1-cF_1wmg-a1-m1-cE.pdb.gz
Full biological assembly
Download: 1wmg-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1wmg/1/1:B/1:A 1wmg/1/1:D/1:C
Other dimers with similar sequences but different poses
  • 1wmg/1/1:F/1:A 1wmg/1/1:B/1:C
  • [Back to Home]