1wmi/3/1:A/3:C

Sequences
>1wmi-a3-m1-cA (length=88) [Search sequence]
MTYRVKIHKQVVKALQSLPKAHYRRFLEFRDILEYEPVPREKFDVIKLEGTGDLDLYRAR
LGDYRVIYSVNWKDKVIKILKLKPRGRA
>1wmi-a3-m3-cC (length=88) [Search sequence]
MTYRVKIHKQVVKALQSLPKAHYRRFLEFRDILEYEPVPREKFDVIKLEGTGDLDLYRAR
LGDYRVIYSVNWKDKVIKILKLKPRGRA
Structure information
PDB ID 1wmi (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of archaeal RelE-RelB complex from Pyrococcus horikoshii OT3
Assembly ID 3
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 24
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 3
Chain ID A C
UniProt accession O73966 O73966
Species 70601 (Pyrococcus horikoshii OT3) 70601 (Pyrococcus horikoshii OT3)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1wmi-a3-m1-cA_1wmi-a3-m3-cC.pdb.gz
Full biological assembly
Download: 1wmi-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1wmi/2/1:A/3:C 1wmi/2/2:A/4:C

[Back to Home]