1wmi/3/1:B/3:D

Sequences
>1wmi-a3-m1-cB (length=61) [Search sequence]
GDVLKELERLKVEIQRLEAMLMPEERDEDITEEEIAELLELARDEDPENWIDAEELPEPE
D
>1wmi-a3-m3-cD (length=61) [Search sequence]
GDVLKELERLKVEIQRLEAMLMPEERDEDITEEEIAELLELARDEDPENWIDAEELPEPE
D
Structure information
PDB ID 1wmi (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of archaeal RelE-RelB complex from Pyrococcus horikoshii OT3
Assembly ID 3
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 24
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 3
Chain ID B D
UniProt accession O73967 O73967
Species 70601 (Pyrococcus horikoshii OT3) 70601 (Pyrococcus horikoshii OT3)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1wmi-a3-m1-cB_1wmi-a3-m3-cD.pdb.gz
Full biological assembly
Download: 1wmi-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1wmi/2/1:B/3:D 1wmi/2/2:B/4:D
Other dimers with similar sequences but different poses
  • 1wmi/4/1:B/4:D 1wmi/2/1:B/4:D 1wmi/2/2:B/3:D
  • [Back to Home]