1wnr/1/1:D/1:E

Sequences

>1wnr-a1-m1-cD (length=75) [Search sequence]

MIKPLGDRVVVKRIPQKGKVIAVGTGRVLENGQRVPLEVKEGDIVVFAKYGGTEIEIDGE EYVILSERDLLAVLQ

>1wnr-a1-m1-cE (length=75) [Search sequence]

MIKPLGDRVVVKRIPQKGKVIAVGTGRVLENGQRVPLEVKEGDIVVFAKYGGTEIEIDGE EYVILSERDLLAVLQ

Structure information

PDB ID	1wnr (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the Cpn10 from Thermus thermophilus HB8
Assembly ID	1
Resolution	2.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	50
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	E
UniProt accession	P61493	P61493
Species	274 (Thermus thermophilus)	274 (Thermus thermophilus)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1wnr-a1-m1-cD_1wnr-a1-m1-cE.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 1wnr-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1wnr/1/1:A/1:B 1wnr/1/1:A/1:G 1wnr/1/1:B/1:C 1wnr/1/1:E/1:F 1wnr/1/1:F/1:G