1wnt/1/1:C/1:D

Sequences

>1wnt-a1-m1-cC (length=244) [Search sequence]

MELFLAGRRVLVTGAGKGIGRGTVQALHATGARVVAVSRTQADLDSLVRECPGIEPVCVD
LGDWEATERALGSVGPVDLLVNNAAVALLQPFLEVTKEAFDRSFEVNLRAVIQVSQIVAR
GLIARGVPGAIVNVSSQCSQRAVTNHSVYCSTKGALDMLTKVMALELGPHKIRVNAVNPT
VVMTSMGQATWSDPHKAKTMLNRIPLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEGG
FWAC

>1wnt-a1-m1-cD (length=244) [Search sequence]

Structure information

PDB ID	1wnt (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of the tetrameric form of Human L-Xylulose Reductase
Assembly ID	1
Resolution	2.3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	10
Sequence identity between the two chains	1.0
PubMed citation	15906319

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	Q7Z4W1	Q7Z4W1
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:1wntC	BioLiP:1wntD

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	1wnt-a1-m1-cC_1wnt-a1-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	1wnt-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1pr9/1/1:A/1:B 1pr9/2/1:A/1:B 1pr9/2/2:A/2:B 1wnt/1/1:A/1:B 3d3w/1/1:A/1:B 3d3w/1/2:A/2:B
Other dimers with similar sequences but different poses	3d3w/4/1:B/2:B 1pr9/2/1:A/2:A 1pr9/2/1:B/2:B 1wnt/1/1:A/1:C 1wnt/1/1:B/1:D 3d3w/1/1:A/2:A 3d3w/1/1:B/2:B 3d3w/3/1:A/2:A 3d3w/2/2:A/1:B 1pr9/2/1:A/2:B 1pr9/2/1:B/2:A 1wnt/1/1:A/1:D 1wnt/1/1:B/1:C 3d3w/1/1:A/2:B 3d3w/1/2:A/1:B