1wp7/1/1:C/1:B

Sequences

>1wp7-a1-m1-cC (length=61) [Search sequence]

NINKLKSSIESTNEAVVKLQETAEKTVYVLTALSSQISSMNQSLQQSKDYIKEAQRLLDT V

>1wp7-a1-m1-cB (length=63) [Search sequence]

NINKLKSSIESTNEAVVKLQETAEKTVYVLTALDISSQISSMNQSLQQSKDYIKEAQRLL DTV

Structure information

PDB ID	1wp7 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	crystal structure of Nipah Virus fusion core
Assembly ID	1
Resolution	2.2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	59
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	B
UniProt accession	Q9IH63	Q9IH63
Species	121791 ()	121791 ()

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1wp7-a1-m1-cC_1wp7-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 1wp7-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1wp7/1/1:B/1:A 1wp7/1/1:C/1:A 1wp8/1/1:A/1:B 1wp8/1/1:C/1:A 1wp8/1/1:C/1:B