1wrl/2/1:D/1:C

Sequences
>1wrl-a2-m1-cD (length=82) [Search sequence]
DIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMID
EVDEDGSGTVDFDEFLVMMVRS
>1wrl-a2-m1-cC (length=83) [Search sequence]
DIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMID
EVDEDGSGTVDFDEFLVMMVRSM
Structure information
PDB ID 1wrl (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the N-terminal domain of human cardiac troponin C in complex with trifluoperazine (monoclinic crystal form)
Assembly ID 2
Resolution 2.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 24
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D C
UniProt accession P63316 P63316
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:1wrlD BioLiP:1wrlC
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1wrl-a2-m1-cD_1wrl-a2-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 1wrl-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1wrk/1/1:B/1:A 1wrl/1/1:A/1:B 1wrl/3/1:F/1:E
Other dimers with similar sequences but different poses
  • 4gjf/2/1:A/2:A 4gje/2/1:A/2:A 4gjg/2/1:A/2:A
  • [Back to Home]