1ws8/1/1:C/1:D

Sequences
>1ws8-a1-m1-cC (length=103) [Search sequence]
MATVHKVGDSTGWTTLVPYDYAKWASSNKFHVGDSLLFNYNNKFHNVLQVDQEQFKSCNS
SSPAASYTSGADSIPLKRPGTFYFLCGIPGHCQLGQKVEIKVD
>1ws8-a1-m1-cD (length=103) [Search sequence]
MATVHKVGDSTGWTTLVPYDYAKWASSNKFHVGDSLLFNYNNKFHNVLQVDQEQFKSCNS
SSPAASYTSGADSIPLKRPGTFYFLCGIPGHCQLGQKVEIKVD
Structure information
PDB ID 1ws8 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of Mavicyanin from Cucurbita pepo medullosa (Zucchini)
Assembly ID 1
Resolution 1.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 22
Sequence identity between the two chains 1.0
PubMed citation 15858169
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession P80728 P80728
Species 3663 (Cucurbita pepo) 3663 (Cucurbita pepo)
Function annotation BioLiP:1ws8C BioLiP:1ws8D
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1ws8-a1-m1-cC_1ws8-a1-m1-cD.pdb.gz
Full biological assembly
Download: 1ws8-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1ws7/1/1:B/1:A 1ws7/1/1:C/1:D 1ws8/1/1:B/1:A
Other dimers with similar sequences but different poses
  • 1ws8/1/1:B/1:C 1ws7/1/1:B/1:C
  • 1ws8/1/1:B/1:D 1ws7/1/1:B/1:D 1ws7/1/1:C/1:A 1ws8/1/1:C/1:A
  • [Back to Home]