1wuw/1/1:A/1:B

Sequences
>1wuw-a1-m1-cA (length=45) [Search sequence]
KSCCRSTLGRNCYNLCRVRGAQKLCANACRCKLTSGLKCPSSFPK
>1wuw-a1-m1-cB (length=45) [Search sequence]
KSCCRSTLGRNCYNLCRVRGAQKLCANACRCKLTSGLKCPSSFPK
Structure information
PDB ID 1wuw (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of beta hordothionin
Assembly ID 1
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 46
Sequence identity between the two chains 1.0
PubMed citation 15848162
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P21742 P21742
Species 4513 (Hordeum vulgare) 4513 (Hordeum vulgare)
Function annotation BioLiP:1wuwA BioLiP:1wuwB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1wuw-a1-m1-cA_1wuw-a1-m1-cB.pdb.gz
Full biological assembly
Download: 1wuw-assembly1.cif.gz

[Back to Home]