1wvl/1/2:A/2:B

Sequences
>1wvl-a1-m2-cA (length=80) [Search sequence]
MVKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLAR
AEREKKGVLKKLRAVENELH
>1wvl-a1-m2-cB (length=80) [Search sequence]
MVKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLAR
AEREKKGVLKKLRAVENELH
Structure information
PDB ID 1wvl (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of Multimeric DNA-binding Protein Sac7d-GCN4 with DNA decamer
Assembly ID 1
Resolution 2.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 39
Sequence identity between the two chains 1.0
PubMed citation 16028219
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID A B
UniProt accession P13123 P13123
Species 2285 (Sulfolobus acidocaldarius) 2285 (Sulfolobus acidocaldarius)
Function annotation BioLiP:1wvlA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1wvl-a1-m2-cA_1wvl-a1-m2-cB.pdb.gz
Full biological assembly
Download: 1wvl-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 1wvl/1/1:B/2:B 1wvl/1/1:A/2:A
  • 1wvl/1/1:A/2:B 1wvl/1/1:B/2:A
  • [Back to Home]