1wzd/1/1:B/1:A

Sequences

>1wzd-a1-m1-cB (length=207) [Search sequence]

GLAVELKQSTAQAHEKAEHSTFMSDLLKGRLGVAEFTRLQEQAWLFYTALEQAVDAVRAS
GFAESLLDPALNRAEVLARDLDKLNGSSEWRSRITASPAVIDYVNRLEEIRDNVDGPALV
AHHYVRYLGDLSGGQVIARMMQRHYGVDPEALGFYHFEGIAKLKVYKDEYREKLNNLELS
DEQREHLLKEATDAFVFNHQVFADLGK

>1wzd-a1-m1-cA (length=209) [Search sequence]

Structure information

PDB ID	1wzd (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure Of An Artificial Metalloprotein: Fe(10-CH2CH2COOH-Salophen)/Wild Type Heme oxygenase
Assembly ID	1
Resolution	1.35Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	28
Sequence identity between the two chains	1.0
PubMed citation	16769893

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	Q54AI1	Q54AI1
Species	1717 (Corynebacterium diphtheriae)	1717 (Corynebacterium diphtheriae)
Function annotation	BioLiP:1wzdB	BioLiP:1wzdA

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	1wzd-a1-m1-cB_1wzd-a1-m1-cA.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	1wzd-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1wzf/1/1:B/1:A 1wzg/1/1:A/1:B
Other dimers with similar sequences but different poses	1wnw/4/2:C/1:B 1wnv/4/2:C/1:B