1x0g/1/1:A/1:D

Sequences

>1x0g-a1-m1-cA (length=102) [Search sequence]

MVELTPAAIQELERLQILRIQVQPSECGDWRYDLALVAEPKPTDLLTQSQGWTIAIAAEA AELLRGLRVDYIEDLMGGAFRFHNPNASQTCGCGMAFRVSRS

>1x0g-a1-m1-cD (length=104) [Search sequence]

MVELTPAAIQELERLQTHAAILRIQVQPSECGDWRYDLALVAEPKPTDLLTQSQGWTIAI AAEAAELLRGLRVDYIEDLMGGAFRFHNPNASQTCGCGMAFRVS

Structure information

PDB ID	1x0g (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of IscA with the [2Fe-2S] cluster
Assembly ID	1
Resolution	2.5Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	57
Sequence identity between the two chains	0.98
PubMed citation	16730357

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	D
UniProt accession	Q8DLM0	Q8DLM0
Species	197221 (Thermosynechococcus vestitus BP-1)	197221 (Thermosynechococcus vestitus BP-1)
Function annotation	BioLiP:1x0gA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1x0g-a1-m1-cA_1x0g-a1-m1-cD.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 1x0g-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

1x0g/1/1:D/1:C 1x0g/1/1:A/1:B