1x0g/1/1:D/1:C

Sequences
>1x0g-a1-m1-cD (length=104) [Search sequence]
MVELTPAAIQELERLQTHAAILRIQVQPSECGDWRYDLALVAEPKPTDLLTQSQGWTIAI
AAEAAELLRGLRVDYIEDLMGGAFRFHNPNASQTCGCGMAFRVS
>1x0g-a1-m1-cC (length=111) [Search sequence]
MVELTPAAIQELERLQTHGVRRGQAAILRIQVQPSECGDWRYDLALVAEPKPTDLLTQSQ
GWTIAIAAEAAELLRGLRVDYIEDLMGGAFRFHNPNASQTCGCGMAFRVSR
Structure information
PDB ID 1x0g (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of IscA with the [2Fe-2S] cluster
Assembly ID 1
Resolution 2.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 33
Sequence identity between the two chains 1.0
PubMed citation 16730357
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D C
UniProt accession Q8DLM0 Q8DLM0
Species 197221 (Thermosynechococcus vestitus BP-1) 197221 (Thermosynechococcus vestitus BP-1)
Function annotation BioLiP:1x0gC
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1x0g-a1-m1-cD_1x0g-a1-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 1x0g-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 1x0g/1/1:A/1:D 1x0g/1/1:B/1:C
  • [Back to Home]