1x0p/1/1:H/1:C

Sequences
>1x0p-a1-m1-cH (length=138) [Search sequence]
GLHRLIYLSCATDGLSYPDLRDIMAKSEVNNLRDGITGMLCYGNGMFLQTLEGDRQKVSE
TYARILKDPRHHSAEIVEFKAIEERTFINWSMRLVQLGEMDSDTIRRLRLKYSPAATFQP
RSMTAEQCFRFLKELYDM
>1x0p-a1-m1-cC (length=139) [Search sequence]
GLHRLIYLSCATDGLSYPDLRDIMAKSEVNNLRDGITGMLCYGNGMFLQTLEGDRQKVSE
TYARILKDPRHHSAEIVEFKAIEERTFINWSMRLVQLGEMDSDTIRRLRLKYSPAATFQP
RSMTAEQCFRFLKELYDMS
Structure information
PDB ID 1x0p (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of a cyanobacterial BLUF protein, Tll0078
Assembly ID 1
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 52
Sequence identity between the two chains 1.0
PubMed citation 15876364
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID H C
UniProt accession Q8DMN3 Q8DMN3
Species 197221 (Thermosynechococcus vestitus BP-1) 197221 (Thermosynechococcus vestitus BP-1)
Function annotation BioLiP:1x0pH BioLiP:1x0pC
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1x0p-a1-m1-cH_1x0p-a1-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 1x0p-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1x0p/1/1:A/1:F 1x0p/1/1:B/1:G 1x0p/1/1:D/1:I 1x0p/1/1:J/1:E
Other dimers with similar sequences but different poses
  • 1x0p/1/1:H/1:G 1x0p/1/1:B/1:C 1x0p/1/1:B/1:F 1x0p/1/1:C/1:D 1x0p/1/1:D/1:E 1x0p/1/1:E/1:F 1x0p/1/1:G/1:A 1x0p/1/1:H/1:I 1x0p/1/1:J/1:A 1x0p/1/1:J/1:I
  • [Back to Home]