1x3e/1/2:A/2:B

Sequences

>1x3e-a1-m2-cA (length=110) [Search sequence]

GDTTITVVGNLTADPELRFTPSGAAVANFTVASTPRMEWKDGEALFLRCNIWREAAENVA ESLTRGSRVIVTGRLKQRSFETREKRTVVEVEVDEIGPSLRYATAKVNKA

>1x3e-a1-m2-cB (length=119) [Search sequence]

AGDTTITVVGNLTADPELRFTPSGAAVANFTVASTPRMFDRQSGEWKDGEALFLRCNIWR EAAENVAESLTRGSRVIVTGRLKQRSFETREGEKRTVVEVEVDEIGPSLRYATAKVNKA

Structure information

PDB ID	1x3e (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the single-stranded DNA-binding protein from Mycobacterium smegmatis
Assembly ID	1
Resolution	2.15Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	112
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	2	2
Chain ID	A	B
UniProt accession	Q9AFI5	Q9AFI5
Species	1772 (Mycolicibacterium smegmatis)	1772 (Mycolicibacterium smegmatis)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1x3e-a1-m2-cA_1x3e-a1-m2-cB.pdb.gz

Full biological assembly Download: 1x3e-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1x3e/1/1:A/1:B 3a5u/1/1:B/2:B
Other dimers with similar sequences but different poses	1x3e/1/1:A/2:A 1x3f/1/1:A/2:A