1x7i/1/1:A/1:B

Sequences

>1x7i-a1-m1-cA (length=236) [Search sequence]

MALLEICCYSMECALTAQQNGADRVELCAAPKEGGLTPSLGVLKSVRQRVTIPVHPIIRP
RGGDFCYSDGEFAAILEDVRTVRELGFPGLVTGVLDVDGNVDMPRMEKIMAAAGPLAVTF
HRAFDMCANPLYTLNNLAELGIARVLTSGQKSDALQGLSKIMELIAHRDAPIIMAGAGVR
AENLHHFLDAGVLEVHSSAGAWQASPMRYRDEYSRYIVDGAAVAEMKGIIERHQAK

>1x7i-a1-m1-cB (length=238) [Search sequence]

Structure information

PDB ID	1x7i (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the native copper homeostasis protein (cutCm) with calcium binding from Shigella flexneri 2a str. 301
Assembly ID	1
Resolution	1.7Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	176
Sequence identity between the two chains	0.996
PubMed citation	15624211

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	P67825	P67825
Species	198214 (Shigella flexneri 2a str. 301)	198214 (Shigella flexneri 2a str. 301)
Function annotation	BioLiP:1x7iB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	1x7i-a1-m1-cA_1x7i-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	1x7i-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1twd/1/1:A/1:B 1x8c/1/1:A/1:B