1xb1/2/2:F/1:A

Sequences
>1xb1-a2-m2-cF (length=89) [Search sequence]
NLPRNPSMTGYEARLITFGTWMYSVNKEQLARAGFYAIGQEDKVQCFHCGGGLANWKPKE
DPWEQHAKWYPGCKYLLEEKGHEYINNIH
>1xb1-a2-m1-cA (length=90) [Search sequence]
NLPRNPSMTGYEARLITFGTWMYSVNKEQLARAGFYAIGQEDKVQCFHCGGGLANWKPKE
DPWEQHAKWYPGCKYLLEEKGHEYINNIHL
Structure information
PDB ID 1xb1 (database links: RCSB PDB PDBe PDBj PDBsum)
Title The Structure of the BIR domain of IAP-like protein 2
Assembly ID 2
Resolution 2.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 21
Sequence identity between the two chains 1.0
PubMed citation 15485395
Chain information
Chain 1 Chain 2
Model ID 2 1
Chain ID F A
UniProt accession Q96P09 Q96P09
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:1xb1F BioLiP:1xb1A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1xb1-a2-m2-cF_1xb1-a2-m1-cA.pdb.gz
Full biological assembly
Download: 1xb1-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1xb1/2/1:B/2:E 1xb1/2/1:C/2:D 1xb1/2/1:D/2:C 1xb1/2/1:E/2:B 1xb1/2/1:F/2:A
Other dimers with similar sequences but different poses
  • 1xb0/1/1:E/1:F 1xb0/1/1:A/1:F 1xb0/1/1:C/1:B 1xb0/1/1:C/1:D 1xb0/1/1:D/1:E 1xb1/1/1:A/1:B 1xb1/1/1:C/1:B 1xb1/1/1:C/1:D 1xb1/1/1:D/1:E 1xb1/1/1:F/1:A 1xb1/1/1:F/1:E 1xb1/2/1:A/1:B 1xb1/2/1:C/1:B 1xb1/2/1:C/1:D 1xb1/2/1:D/1:E 1xb1/2/1:F/1:A 1xb1/2/1:F/1:E 1xb1/2/2:A/2:B 1xb1/2/2:C/2:B 1xb1/2/2:C/2:D 1xb1/2/2:D/2:E 1xb1/2/2:F/2:A 1xb1/2/2:F/2:E
  • 1xb1/2/2:F/1:B 1xb1/2/1:C/2:E 1xb1/2/1:F/2:B 1xb1/2/2:C/1:E
  • [Back to Home]