1xdk/3/1:B/1:F

Sequences

>1xdk-a3-m1-cB (length=245) [Search sequence]

AELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVE
FAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAG
FGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKI
YIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHE
PLTPS

>1xdk-a3-m1-cF (length=245) [Search sequence]

Structure information

PDB ID	1xdk (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of the RARbeta/RXRalpha Ligand Binding Domain Heterodimer in Complex with 9-cis Retinoic Acid and a Fragment of the TRAP220 Coactivator
Assembly ID	3
Resolution	2.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	75
Sequence identity between the two chains	1.0
PubMed citation	15528208

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	F
UniProt accession	P22605	P22605
Species	10090 (Mus musculus)	10090 (Mus musculus)
Function annotation	BioLiP:1xdkB	BioLiP:1xdkF

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	1xdk-a3-m1-cB_1xdk-a3-m1-cF.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	1xdk-assembly3.cif.gz