1xed/7/1:C/1:B

Sequences
>1xed-a7-m1-cC (length=105) [Search sequence]
PIFGPEEVNSVEGNSVSITCYYPPTSVNRHTRKYWCRQCITLISSEGYVSSKYAGRANLT
NFPENGTFVVNIAQLSQDDSGRYKCGLGINSRGLSFDVSLEVLEH
>1xed-a7-m1-cB (length=109) [Search sequence]
PIFGPEEVNSVEGNSVSITCYYPPTSVNRHTRKYWCRQCITLISSEGYVSSKYAGRANLT
NFPENGTFVVNIAQLSQDDSGRYKCGLGINSRGLSFDVSLEVLEHHHHH
Structure information
PDB ID 1xed (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of a Ligand-Binding Domain of the Human Polymeric Ig Receptor, pIgR
Assembly ID 7
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 27
Sequence identity between the two chains 1.0
PubMed citation 15530357
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C B
UniProt accession P01833 P01833
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:1xedB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1xed-a7-m1-cC_1xed-a7-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 1xed-assembly7.cif.gz

[Back to Home]