1xed/7/1:C/1:B

Sequences

>1xed-a7-m1-cC (length=105) [Search sequence]

PIFGPEEVNSVEGNSVSITCYYPPTSVNRHTRKYWCRQCITLISSEGYVSSKYAGRANLT NFPENGTFVVNIAQLSQDDSGRYKCGLGINSRGLSFDVSLEVLEH

>1xed-a7-m1-cB (length=109) [Search sequence]

PIFGPEEVNSVEGNSVSITCYYPPTSVNRHTRKYWCRQCITLISSEGYVSSKYAGRANLT NFPENGTFVVNIAQLSQDDSGRYKCGLGINSRGLSFDVSLEVLEHHHHH

Structure information

PDB ID	1xed (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of a Ligand-Binding Domain of the Human Polymeric Ig Receptor, pIgR
Assembly ID	7
Resolution	1.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	27
Sequence identity between the two chains	1.0
PubMed citation	15530357

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	B
UniProt accession	P01833	P01833
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:1xedB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1xed-a7-m1-cC_1xed-a7-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 1xed-assembly7.cif.gz