1xed/9/1:C/1:A

Sequences

>1xed-a9-m1-cC (length=105) [Search sequence]

PIFGPEEVNSVEGNSVSITCYYPPTSVNRHTRKYWCRQCITLISSEGYVSSKYAGRANLT NFPENGTFVVNIAQLSQDDSGRYKCGLGINSRGLSFDVSLEVLEH

>1xed-a9-m1-cA (length=111) [Search sequence]

SPIFGPEEVNSVEGNSVSITCYYPPTSVNRHTRKYWCRQCITLISSEGYVSSKYAGRANL TNFPENGTFVVNIAQLSQDDSGRYKCGLGINSRGLSFDVSLEVLEHHHHHH

Structure information

PDB ID	1xed (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of a Ligand-Binding Domain of the Human Polymeric Ig Receptor, pIgR
Assembly ID	9
Resolution	1.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	59
Sequence identity between the two chains	1.0
PubMed citation	15530357

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	A
UniProt accession	P01833	P01833
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:1xedA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1xed-a9-m1-cC_1xed-a9-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 1xed-assembly9.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1xed/7/1:C/1:A 1xed/7/1:D/1:B 1xed/8/1:D/1:B
Other dimers with similar sequences but different poses	1xed/7/1:C/1:D 1xed/7/1:B/1:A