1xj6/5/1:A/1:B

Sequences
>1xj6-a5-m1-cA (length=105) [Search sequence]
PDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSD
PHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLT
>1xj6-a5-m1-cB (length=107) [Search sequence]
TIPDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTT
SDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLT
Structure information
PDB ID 1xj6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of bjFixLH in the unliganded ferrous form
Assembly ID 5
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 61
Sequence identity between the two chains 1.0
PubMed citation 15779889
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P23222 P23222
Species 375 (Bradyrhizobium japonicum) 375 (Bradyrhizobium japonicum)
Function annotation BioLiP:1xj6A BioLiP:1xj6B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1xj6-a5-m1-cA_1xj6-a5-m1-cB.pdb.gz
Full biological assembly
Download: 1xj6-assembly5.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1xj4/3/1:A/1:B 1xj4/3/2:A/2:B 1xj4/4/1:A/1:B 1xj4/4/3:A/3:B 1xj4/5/1:A/1:B 1xj6/3/1:A/1:B 1xj6/3/2:A/2:B 1xj6/4/1:A/1:B 1xj6/4/3:A/3:B 2vv6/1/1:A/1:B 2vv6/2/1:C/1:D 2vv7/1/1:A/1:B 2vv7/1/1:C/1:D 2vv8/1/1:A/1:B 2vv8/1/1:C/1:D
Other dimers with similar sequences but different poses
  • 1xj4/6/1:A/2:A 1xj4/3/1:A/2:A
  • 1xj4/4/1:A/3:A 1xj6/4/1:A/3:A
  • 2cmn/1/3:A/6:A 2cmn/1/1:A/4:A 2cmn/1/1:A/5:A 2cmn/1/2:A/3:A 2cmn/1/2:A/6:A 2cmn/1/4:A/5:A
  • 2cmn/1/1:A/6:A 2cmn/1/2:A/5:A 2cmn/1/3:A/4:A
  • 2vv8/1/1:B/1:D 2vv7/1/1:B/1:D
  • [Back to Home]