1xky/1/1:A/1:D

Sequences

>1xky-a1-m1-cA (length=292) [Search sequence]

MIDFGTIATAMVTPFDINGNIDFAKTTKLVNYLIDNGTTAIVVGGTTGESPTLTSEEKVA
LYRHVVSVVDKRVPVIAGTGSNNTHASIDLTKKATEVGVDAVMLVAPYYNKPSQEGMYQH
FKAIAESTPLPVMLYNVPGRSIVQISVDTVVRLSEIENIVAIKDAGGDVLTMTEIIEKTA
DDFAVYSGDDGLTLPAMAVGAKGIVSVASHVIGNEMQEMIAAFQAGEFKKAQKLHQLLVR
VTDSLFMAPSPTPVKTALQMVGLDVGSVRLPLLPLTEEERVTLQSVMQSIPR

>1xky-a1-m1-cD (length=292) [Search sequence]

Structure information

PDB ID	1xky (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of Dihydrodipicolinate Synthase DapA-2 (BA3935) from Bacillus Anthracis at 1.94A Resolution.
Assembly ID	1
Resolution	1.94Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	58
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	D
UniProt accession	A0A6L7H340	A0A6L7H340
Species	1392 (Bacillus anthracis)	1392 (Bacillus anthracis)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	1xky-a1-m1-cA_1xky-a1-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	1xky-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1xky/1/1:B/1:C 1xl9/1/1:A/1:D 1xl9/1/1:B/1:C 3hij/1/1:A/1:D 3hij/1/1:B/1:C
Other dimers with similar sequences but different poses	1xky/1/1:C/1:D 1xky/1/1:A/1:B 1xl9/1/1:A/1:B 1xl9/1/1:C/1:D 3hij/1/1:A/1:B 3hij/1/1:C/1:D