1xlq/4/1:A/1:B

Sequences

>1xlq-a4-m1-cA (length=106) [Search sequence]

SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKV PAANEREIGMLESVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW

>1xlq-a4-m1-cB (length=106) [Search sequence]

SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKV PAANEREIGMLESVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW

Structure information

PDB ID	1xlq (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of reduced C73S putidaredoxin from Pseudomonas putida
Assembly ID	4
Resolution	1.45Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	60
Sequence identity between the two chains	1.0
PubMed citation	15755454

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	P00259	P00259
Species	303 (Pseudomonas putida)	303 (Pseudomonas putida)
Function annotation	BioLiP:1xlqA	BioLiP:1xlqB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1xlq-a4-m1-cA_1xlq-a4-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 1xlq-assembly4.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1oqr/4/1:B/2:C 1xlp/4/1:B/2:C