1xq4/1/1:D/1:A

Sequences
>1xq4-a1-m1-cD (length=120) [Search sequence]
PVKPYDLTVSVTPRYVPEQSDPSQQQYVFAYTVRITNTGSHPAQVISRHWIITDGEERVQ
EVRGLGVVGQQPLLAPGETFEYTSGCPLPTPIGTRGTYHCVGENGIPFEVPIAEFLLAPR
>1xq4-a1-m1-cA (length=121) [Search sequence]
PVKPYDLTVSVTPRYVPEQSDPSQQQYVFAYTVRITNTGSHPAQVISRHWIITDGEERVQ
EVRGLGVVGQQPLLAPGETFEYTSGCPLPTPIGTRGTYHCVGENGIPFEVPIAEFLLAPR
T
Structure information
PDB ID 1xq4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of the Putative ApaA Protein from Bordetella pertussis, Northeast Structural Genomics Target BeR40
Assembly ID 1
Resolution 2.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 54
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D A
UniProt accession Q7VU61 Q7VU61
Species 520 (Bordetella pertussis) 520 (Bordetella pertussis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1xq4-a1-m1-cD_1xq4-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 1xq4-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 1xq4/1/1:B/1:D 1xq4/1/1:C/1:A
  • [Back to Home]