1xre/1/1:A/1:B

Sequences

>1xre-a1-m1-cA (length=201) [Search sequence]

SFQLPKLSYDYDELEPYIDSNTLSIHHGKHHATYVNNLNAALENYSELHNKSLEELLCNL
ETLPKEIVTAVRNNGGGHYCHSLFWEVMSPRGGGEPNGDVAKVIDYYFNTFDNLKDQLSK
AAISRFGSGYGWLVLDGEELSVMSTPNQDTPLQEGKIPLLVIDVWEHAYYLKYQNRRPEF
VTNWWHTVNWDRVNEKYLQAI

>1xre-a1-m1-cB (length=201) [Search sequence]

Structure information

PDB ID	1xre (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of SodA-2 (BA5696) from Bacillus anthracis at 1.8A Resolution.
Assembly ID	1
Resolution	1.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	47
Sequence identity between the two chains	1.0
PubMed citation	16511113

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q81JK8	Q81JK8
Species	1392 (Bacillus anthracis)	1392 (Bacillus anthracis)
Function annotation	BioLiP:1xreA	BioLiP:1xreB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	1xre-a1-m1-cA_1xre-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	1xre-assembly1.cif.gz