1xt3/1/1:A/2:B

Sequences
>1xt3-a1-m1-cA (length=60) [Search sequence]
LKCNKLVPLFYKTCPAGKNLCYKMFMVATPKVPVKRGCIDVCPKSSLLVKYVCCNTDRCN
>1xt3-a1-m2-cB (length=60) [Search sequence]
LKCNKLVPLFYKTCPAGKNLCYKMFMVATPKVPVKRGCIDVCPKSSLLVKYVCCNTDRCN
Structure information
PDB ID 1xt3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure Basis of Venom Citrate-Dependent Heparin Sulfate-Mediated Cell Surface Retention of Cobra Cardiotoxin A3
Assembly ID 1
Resolution 2.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 25
Sequence identity between the two chains 1.0
PubMed citation 15590643
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A B
UniProt accession P60301 P60301
Species 8656 (Naja atra) 8656 (Naja atra)
Function annotation BioLiP:1xt3A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1xt3-a1-m1-cA_1xt3-a1-m2-cB.pdb.gz
Full biological assembly
Download: 1xt3-assembly1.cif.gz

[Back to Home]