1xtu/2/1:B/1:F

Sequences

>1xtu-a2-m1-cB (length=215) [Search sequence]

PLYVIDKPITLHILTQLRDKYTDQINFRKNLVRLGRILGYEISNTLDYEIVEVETPLGVK
TKGVDITDLNNIVIINILRAAVPLVEGLLKAFPKARQGVIGASRVEVDGKEVPKDMDVYI
YYKKIPDIRAKVDNVIIADPMIATASTMLKVLEEVVKANPKRIYIVSIISSEYGVNKILS
KYPFIYLFTVAIDPELNNKGYILPGLGDAGDRAFG

>1xtu-a2-m1-cF (length=215) [Search sequence]

Structure information

PDB ID	1xtu (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Sulfolobus solfataricus uracil phosphoribosyltransferase in complex with uridine 5'-monophosphate (UMP) and cytidine 5'-triphosphate (CTP)
Assembly ID	2
Resolution	2.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	125
Sequence identity between the two chains	1.0
PubMed citation	15654744

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	F
UniProt accession	Q980Q4	Q980Q4
Species	2287 (Saccharolobus solfataricus)	2287 (Saccharolobus solfataricus)
Function annotation	BioLiP:1xtuB	BioLiP:1xtuF

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	1xtu-a2-m1-cB_1xtu-a2-m1-cF.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	1xtu-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1vst/1/1:A/2:A 1vst/1/3:A/4:A 1xtt/1/1:B/1:A 1xtt/1/1:D/1:C 1xtu/1/1:A/1:E 1xtu/1/1:D/1:H 1xtu/2/1:C/1:G 1xtv/1/1:A/1:B 1xtv/1/1:C/1:D 1xtv/2/1:E/1:F 1xtv/2/1:G/1:H 3g6w/1/1:B/1:A 3g6w/1/1:C/1:D
Other dimers with similar sequences but different poses	1xtu/2/1:C/1:F 1vst/1/1:A/3:A 1vst/1/2:A/4:A 1xtt/1/1:B/1:C 1xtt/1/1:D/1:A 1xtu/1/1:A/1:H 1xtu/1/1:D/1:E 1xtu/2/1:B/1:G 1xtv/1/1:A/1:D 1xtv/1/1:B/1:C 1xtv/2/1:E/1:H 1xtv/2/1:F/1:G 3g6w/1/1:B/1:D 3g6w/1/1:C/1:A