1xty/2/1:C/1:D

Sequences

>1xty-a2-m1-cC (length=120) [Search sequence]

MIKMVIVVRSDIKMGKGKIAAQVAHAAVTLVVSIINSNNLRWKEWLNEWLHQGQPKIIVK VNSLDEIISRAKKAETMNLPFSIIEDAGKTQLEPGTITCLGIGPAPENLVDSITGDLKLL

>1xty-a2-m1-cD (length=120) [Search sequence]

MIKMVIVVRSDIKMGKGKIAAQVAHAAVTLVVSIINSNNLRWKEWLNEWLHQGQPKIIVK VNSLDEIISRAKKAETMNLPFSIIEDAGKTQLEPGTITCLGIGPAPENLVDSITGDLKLL

Structure information

PDB ID	1xty (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of Sulfolobus solfataricus peptidyl-tRNA hydrolase
Assembly ID	2
Resolution	1.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	75
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	Q980V1	Q980V1
Species	273057 (Saccharolobus solfataricus P2)	273057 (Saccharolobus solfataricus P2)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1xty-a2-m1-cC_1xty-a2-m1-cD.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 1xty-assembly2.cif.gz

Similar dimers