1xwk/1/1:A/1:C

Sequences

>1xwk-a1-m1-cA (length=217) [Search sequence]

PMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLP
YLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFE
KLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNL
KDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK

>1xwk-a1-m1-cC (length=217) [Search sequence]

Structure information

PDB ID	1xwk (database links: RCSB PDB PDBe PDBj PDBsum)
Title	2.3 angstrom resolution crystal structure of human glutathione S-transferase M1A-1A complexed with glutathionyl-S-dinitrobenzene
Assembly ID	1
Resolution	2.3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	72
Sequence identity between the two chains	1.0
PubMed citation	16548513

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	C
UniProt accession	P09488	P09488
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:1xwkA	BioLiP:1xwkC

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	1xwk-a1-m1-cA_1xwk-a1-m1-cC.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	1xwk-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1gtu/1/1:A/1:B 1gtu/2/1:C/1:D 1xw6/1/1:A/1:B 1xw6/2/1:C/1:D 1xwk/2/1:B/2:B 1yj6/1/1:A/1:B 1yj6/2/1:C/2:C 2f3m/1/1:A/1:B 2f3m/2/1:C/1:D 2f3m/3/1:E/1:F 7beu/1/1:A/1:D 7beu/2/1:B/1:C