1xwr/1/1:B/1:A

Sequences
>1xwr-a1-m1-cB (length=77) [Search sequence]
ANKRNEALRIESALLNKIAMLGTEKTAEAVGVDKSQISRWKRDWIPKFSMLLAVLEWGVV
DDDMARLARQVAAILTN
>1xwr-a1-m1-cA (length=79) [Search sequence]
VRANKRNEALRIESALLNKIAMLGTEKTAEAVGVDKSQISRWKRDWIPKFSMLLAVLEWG
VVDDDMARLARQVAAILTN
Structure information
PDB ID 1xwr (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the coliphage lambda transcription activator protein CII
Assembly ID 1
Resolution 2.56Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 74
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession P03042 P03042
Species 10710 (Lambdavirus lambda) 10710 (Lambdavirus lambda)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1xwr-a1-m1-cB_1xwr-a1-m1-cA.pdb.gz
Full biological assembly
Download: 1xwr-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1zpq/1/1:A/1:B 1zs4/1/1:A/1:B 8igr/1/1:B/1:A
Other dimers with similar sequences but different poses
  • 1xwr/1/1:D/1:A 1zpq/1/1:A/1:C
  • 1xwr/1/1:B/1:D 1zpq/1/1:B/1:C
  • 1xwr/1/1:C/1:D 1zpq/1/1:C/1:D 1zs4/1/1:D/1:C 8igr/1/1:D/1:C
  • 1zs4/1/1:C/1:A 8igr/1/1:A/1:C
  • 1zs4/1/1:C/1:B 8igr/1/1:B/1:C
  • 1zs4/1/1:D/1:A 8igr/1/1:D/1:A
  • [Back to Home]